PE Rabbit anti-Mouse CD301b/MGL2 mAb, Monoclonal

Catalog Number: ABB-A28266
Article Name: PE Rabbit anti-Mouse CD301b/MGL2 mAb, Monoclonal
Biozol Catalog Number: ABB-A28266
Supplier Catalog Number: A28266
Alternative Catalog Number: ABB-A28266-25UG,ABB-A28266-100UG
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: FC
Species Reactivity: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: PE
Alternative Names: CD301b
Enables carbohydrate binding activity. Predicted to be involved in immune response. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including hemolymphoid system gland, ileum, liver, lung, and male reproductive gland or organ. Orthologous to human CLEC10A (C-type lectin domain containing 10A).
Clonality: Monoclonal
Concentration: FC
Molecular Weight: 38 kDa
NCBI: 216864
UniProt: Q8JZN1
Purity: Affinity purification
Sequence: QNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP
Target: Mgl2
Application Dilute: FC,0.5 µg per million cells in 100 µl volume
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Flow cytometry: 1X10 6 C57BL/6 Bone Marrow-Derived Dendritic Cells were surface-stained with ABflo 488 Armenian Hamster anti-Mouse CD11c mAb (A26927,5 µl/Test) and PE Rabbit IgG isotype control (A24172,5 µl/Test,left) or PE Rabbit anti-Mouse CD301b/MGL2 mAb (A28266,0.5 µg,right).