APC Rabbit anti-Mouse IL-4 mAb, Monoclonal

Artikelnummer: ABB-A28267
Artikelname: APC Rabbit anti-Mouse IL-4 mAb, Monoclonal
Artikelnummer: ABB-A28267
Hersteller Artikelnummer: A28267
Alternativnummer: ABB-A28267-100UG,ABB-A28267-25UG
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: APC
Alternative Synonym: Il-4, BSF-1
IL-4 is a pleiotropic cytokine produced by activated T cells, mast cells, and basophils. It serves as a potent lymphocyte growth factor that stimulates the growth and activation of certain B and T cells. IL-4 plays a critical role in regulating the development of T helper cell subsets.
Klonalität: Monoclonal
Konzentration: FC (intra)
Molekulargewicht: 16 kDa
NCBI: 16189
UniProt: P07750
Reinheit: Affinity purification
Sequenz: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Target-Kategorie: Il4
Application Verdünnung: FC (intra),0.5 µg per million cells in 100 µl volume
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology,Innate Immunity,Cytokines,Interleukins,Cancer,Tumor immunology,Cytokines,Interleukins. Shipping: Ice Bag
Flow cytometry: 1X10 6 Th2-polarized C57BL/6 mouse splenocytes ( treated with 50ng/ml PMA + 1ug/ml Ionomycin + 1ug/ml Brefeldin A or 2uM Monensin for 6 hours ) were surface-stained with ABflo 450 Rabbit anti-Mouse CD4 mAb (A25941,5 µl/Test) , then intracellularly-stained with APC Rabbit IgG isotype control (A24173,5 µl/Test,left) and APC Rabbit anti-Mouse IL4 mAb (A28267,0.5 µg,right).