ABflo 647 Rabbit anti-Mouse CD223/LAG-3 mAb, Monoclonal

Artikelnummer: ABB-A28268
Artikelname: ABflo 647 Rabbit anti-Mouse CD223/LAG-3 mAb, Monoclonal
Artikelnummer: ABB-A28268
Hersteller Artikelnummer: A28268
Alternativnummer: ABB-A28268-25UG,ABB-A28268-100UG
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: ABflo 647
Alternative Synonym: Ly66, CD223, LAG-3
Enables MHC class II protein binding activity and transmembrane signaling receptor activity. Involved in negative regulation of regulatory T cell differentiation, plasmacytoid dendritic cell activation, and regulation of immune response. Acts upstream of or within cell surface receptor signaling pathway, negative regulation of interleukin-2 production, and positive regulation of natural killer cell mediated cytotoxicity. Located in external side of plasma membrane and extracellular region. Orthologous to human LAG3 (lymphocyte activating 3).
Klonalität: Monoclonal
Konzentration: FC
Molekulargewicht: 57 kDa
NCBI: 16768
UniProt: Q61790
Reinheit: Affinity purification
Sequenz: GPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDWVLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCHL
Target-Kategorie: LAG-3
Application Verdünnung: FC,0.25 µg per million cells in 100 µl volume
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag
Flow cytometry:1X10 6 C57BL/6 mouse splenocytes (untreated, left) and C57BL/6 mouse splenocytes treated with 2 ug/ml Mouse T Cell Activation Kit (Anti-CD3/CD28) for 3 days (right) were surface-stained with ABflo 488 Rat anti-Mouse CD3 mAb (A27161,5 µl/Test) and ABflo 647 Rabbit anti-Mouse CD223/LAG-3 mAb (A28268,0.25 µg).