ABflo 647 Rabbit anti-Mouse CD223/LAG-3 mAb, Monoclonal

Catalog Number: ABB-A28268
Article Name: ABflo 647 Rabbit anti-Mouse CD223/LAG-3 mAb, Monoclonal
Biozol Catalog Number: ABB-A28268
Supplier Catalog Number: A28268
Alternative Catalog Number: ABB-A28268-25UG,ABB-A28268-100UG
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: FC
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: ABflo 647
Alternative Names: Ly66, CD223, LAG-3
Enables MHC class II protein binding activity and transmembrane signaling receptor activity. Involved in negative regulation of regulatory T cell differentiation, plasmacytoid dendritic cell activation, and regulation of immune response. Acts upstream of or within cell surface receptor signaling pathway, negative regulation of interleukin-2 production, and positive regulation of natural killer cell mediated cytotoxicity. Located in external side of plasma membrane and extracellular region. Orthologous to human LAG3 (lymphocyte activating 3).
Clonality: Monoclonal
Concentration: FC
Molecular Weight: 57 kDa
NCBI: 16768
UniProt: Q61790
Purity: Affinity purification
Sequence: GPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDWVLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCHL
Target: LAG-3
Application Dilute: FC,0.25 µg per million cells in 100 µl volume
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag
Flow cytometry:1X10 6 C57BL/6 mouse splenocytes (untreated, left) and C57BL/6 mouse splenocytes treated with 2 ug/ml Mouse T Cell Activation Kit (Anti-CD3/CD28) for 3 days (right) were surface-stained with ABflo 488 Rat anti-Mouse CD3 mAb (A27161,5 µl/Test) and ABflo 647 Rabbit anti-Mouse CD223/LAG-3 mAb (A28268,0.25 µg).