ARL2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ARL2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2830
• Hersteller Artikelnummer: A2830
• Alternativnummer: ABB-A2830-500UL,ABB-A2830-100UL,ABB-A2830-1000UL,ABB-A2830-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ARFL2, MRCS1, ARL2

Produktbeschreibung

This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 21kDa
• NCBI: 402
• UniProt: P36404
• Reinheit: Affinity purification
• Sequenz: MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD
• Target-Kategorie: ARL2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ARL2 Rabbit pAb (A2830) at 1:3000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.