ARL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2830
- Bilder (1)
| Artikelname: | ARL2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2830 |
| Hersteller Artikelnummer: | A2830 |
| Alternativnummer: | ABB-A2830-500UL,ABB-A2830-100UL,ABB-A2830-1000UL,ABB-A2830-20UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ARFL2, MRCS1, ARL2 |
| This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 21kDa |
| NCBI: | 402 |
| UniProt: | P36404 |
| Reinheit: | Affinity purification |
| Sequenz: | MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD |
| Target-Kategorie: | ARL2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag |

