ARL2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ARL2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2830
• Supplier Catalog Number: A2830
• Alternative Catalog Number: ABB-A2830-500UL,ABB-A2830-100UL,ABB-A2830-1000UL,ABB-A2830-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ARFL2, MRCS1, ARL2

Product Description

This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 21kDa
• NCBI: 402
• UniProt: P36404
• Purity: Affinity purification
• Sequence: MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD
• Target: ARL2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag

Images

Western blot analysis of various lysates using ARL2 Rabbit pAb (A2830) at 1:3000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.