GJD2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: GJD2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2883
• Hersteller Artikelnummer: A2883
• Alternativnummer: ABB-A2883-100UL,ABB-A2883-500UL,ABB-A2883-20UL,ABB-A2883-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CX36, GJA9, GJD2

Produktbeschreibung

This gene encodes a member of the connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component of the gap junction intercellular channel. The channels formed by this protein allow cationic molecule exchange between human beta cells and may function in the regulation of insulin secretion.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 36kDa
• NCBI: 57369
• UniProt: Q9UKL4
• Reinheit: Affinity purification
• Sequenz: HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
• Target-Kategorie: GJD2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using GJD2 Rabbit pAb (A2883) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.