GJD2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GJD2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2883
• Supplier Catalog Number: A2883
• Alternative Catalog Number: ABB-A2883-100UL,ABB-A2883-500UL,ABB-A2883-20UL,ABB-A2883-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CX36, GJA9, GJD2

Product Description

This gene encodes a member of the connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component of the gap junction intercellular channel. The channels formed by this protein allow cationic molecule exchange between human beta cells and may function in the regulation of insulin secretion.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 36kDa
• NCBI: 57369
• UniProt: Q9UKL4
• Purity: Affinity purification
• Sequence: HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
• Target: GJD2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton. Shipping: Ice Bag

Images

Western blot analysis of various lysates using GJD2 Rabbit pAb (A2883) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.