AQP10 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: AQP10 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2888
• Hersteller Artikelnummer: A2888
• Alternativnummer: ABB-A2888-20UL,ABB-A2888-500UL,ABB-A2888-1000UL,ABB-A2888-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AQPA_HUMAN, AQP10

Produktbeschreibung

This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 32kDa
• NCBI: 89872
• UniProt: Q96PS8
• Reinheit: Affinity purification
• Sequenz: CGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
• Target-Kategorie: AQP10
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using AQP10 Rabbit pAb (A2888) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.