AQP10 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: AQP10 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2888
• Supplier Catalog Number: A2888
• Alternative Catalog Number: ABB-A2888-20UL,ABB-A2888-500UL,ABB-A2888-1000UL,ABB-A2888-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: AQPA_HUMAN, AQP10

Product Description

This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 32kDa
• NCBI: 89872
• UniProt: Q96PS8
• Purity: Affinity purification
• Sequence: CGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
• Target: AQP10
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using AQP10 Rabbit pAb (A2888) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.