AQP10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A2888
Article Name: AQP10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A2888
Supplier Catalog Number: A2888
Alternative Catalog Number: ABB-A2888-20UL,ABB-A2888-500UL,ABB-A2888-1000UL,ABB-A2888-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AQPA_HUMAN, AQP10
This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 89872
UniProt: Q96PS8
Purity: Affinity purification
Sequence: CGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
Target: AQP10
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using AQP10 Rabbit pAb (A2888) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.