EGR4 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: EGR4 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2910
• Hersteller Artikelnummer: A2910
• Alternativnummer: ABB-A2910-500UL,ABB-A2910-20UL,ABB-A2910-1000UL,ABB-A2910-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AT133, NGFIC, NGFI-C, PAT133, EGR4

Produktbeschreibung

Enables DNA-binding transcription activator activity, RNA polymerase II-specific and sequence-specific double-stranded DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of chromatin.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 62kDa
• NCBI: 1961
• UniProt: Q05215
• Reinheit: Affinity purification
• Sequenz: GVAAPPVPPPPPTPFPQAKARRKGRRGGKCSTRCFCPRPHAKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFASL
• Target-Kategorie: EGR4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from mouse brain, using EGR4 Rabbit pAb (A2910).
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.