EGR4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: EGR4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2910
• Supplier Catalog Number: A2910
• Alternative Catalog Number: ABB-A2910-500UL,ABB-A2910-20UL,ABB-A2910-1000UL,ABB-A2910-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: AT133, NGFIC, NGFI-C, PAT133, EGR4

Product Description

Enables DNA-binding transcription activator activity, RNA polymerase II-specific and sequence-specific double-stranded DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of chromatin.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 62kDa
• NCBI: 1961
• UniProt: Q05215
• Purity: Affinity purification
• Sequence: GVAAPPVPPPPPTPFPQAKARRKGRRGGKCSTRCFCPRPHAKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFASL
• Target: EGR4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Images

Western blot analysis of lysates from mouse brain, using EGR4 Rabbit pAb (A2910).
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.