CLDND1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CLDND1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2945
• Hersteller Artikelnummer: A2945
• Alternativnummer: ABB-A2945-20UL,ABB-A2945-500UL,ABB-A2945-1000UL,ABB-A2945-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Z38, C3orf4, GENX-3745, CLDND1

Produktbeschreibung

Located in cell surface.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 29kDa
• NCBI: 56650
• UniProt: Q9NY35
• Reinheit: Affinity purification
• Sequenz: GTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWR
• Target-Kategorie: CLDND1

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CLDND1 Rabbit pAb (A2945) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.