CLDND1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CLDND1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2945
• Supplier Catalog Number: A2945
• Alternative Catalog Number: ABB-A2945-20UL,ABB-A2945-500UL,ABB-A2945-1000UL,ABB-A2945-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Z38, C3orf4, GENX-3745, CLDND1

Product Description

Located in cell surface.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 29kDa
• NCBI: 56650
• UniProt: Q9NY35
• Purity: Affinity purification
• Sequence: GTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWR
• Target: CLDND1

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CLDND1 Rabbit pAb (A2945) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.