GJB3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: GJB3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2949
• Hersteller Artikelnummer: A2949
• Alternativnummer: ABB-A2949-500UL,ABB-A2949-1000UL,ABB-A2949-20UL,ABB-A2949-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EKV, CX31, DFNA2, EKVP1, DFNA2B, GJB3

Produktbeschreibung

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene can cause non-syndromic deafness or erythrokeratodermia variabilis, a skin disorder. Alternative splicing results in multiple transcript variants encoding the same protein.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 31kDa
• NCBI: 2707
• UniProt: O75712
• Reinheit: Affinity purification
• Sequenz: ERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIV
• Target-Kategorie: GJB3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:2000 - 1:50000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using GJB3 Rabbit pAb (A2949) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).