GJB3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GJB3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2949
• Supplier Catalog Number: A2949
• Alternative Catalog Number: ABB-A2949-500UL,ABB-A2949-1000UL,ABB-A2949-20UL,ABB-A2949-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EKV, CX31, DFNA2, EKVP1, DFNA2B, GJB3

Product Description

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene can cause non-syndromic deafness or erythrokeratodermia variabilis, a skin disorder. Alternative splicing results in multiple transcript variants encoding the same protein.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 31kDa
• NCBI: 2707
• UniProt: O75712
• Purity: Affinity purification
• Sequence: ERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIV
• Target: GJB3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:2000 - 1:50000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using GJB3 Rabbit pAb (A2949) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).