GFRA3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2955
- Bilder (1)
| Artikelname: | GFRA3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2955 |
| Hersteller Artikelnummer: | A2955 |
| Alternativnummer: | ABB-A2955-100UL,ABB-A2955-500UL,ABB-A2955-20UL,ABB-A2955-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GDNFR3, GFRA3 |
| The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 45kDa |
| NCBI: | 2676 |
| UniProt: | O60609 |
| Reinheit: | Affinity purification |
| Sequenz: | DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCA |
| Target-Kategorie: | GFRA3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Neuroscience. Shipping: Ice Bag |

