GFRA3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GFRA3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2955
• Supplier Catalog Number: A2955
• Alternative Catalog Number: ABB-A2955-100UL,ABB-A2955-500UL,ABB-A2955-20UL,ABB-A2955-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GDNFR3, GFRA3

Product Description

The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 45kDa
• NCBI: 2676
• UniProt: O60609
• Purity: Affinity purification
• Sequence: DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCA
• Target: GFRA3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using GFRA3 Rabbit pAb (A2955) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.