NTSR1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NTSR1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3054
• Hersteller Artikelnummer: A3054
• Alternativnummer: ABB-A3054-100UL,ABB-A3054-1000UL,ABB-A3054-20UL,ABB-A3054-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NTR, NTSR1

Produktbeschreibung

Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secretion.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 46kDa
• NCBI: 4923
• UniProt: P30989
• Reinheit: Affinity purification
• Sequenz: MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVY
• Target-Kategorie: NTSR1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from DU145 cells, using NTSR1 Rabbit pAb (A3054) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.