NTSR1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NTSR1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3054
• Supplier Catalog Number: A3054
• Alternative Catalog Number: ABB-A3054-100UL,ABB-A3054-1000UL,ABB-A3054-20UL,ABB-A3054-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NTR, NTSR1

Product Description

Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secretion.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 46kDa
• NCBI: 4923
• UniProt: P30989
• Purity: Affinity purification
• Sequence: MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVY
• Target: NTSR1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of lysates from DU145 cells, using NTSR1 Rabbit pAb (A3054) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.