HCRTR2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: HCRTR2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3057
• Hersteller Artikelnummer: A3057
• Alternativnummer: ABB-A3057-1000UL,ABB-A3057-500UL,ABB-A3057-100UL,ABB-A3057-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: OX2R, OXR2, ORXR2, HCRTR2

Produktbeschreibung

The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor that selectively binds orexin A.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 51kDa
• NCBI: 3062
• UniProt: O43614
• Reinheit: Affinity purification
• Sequenz: SCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW
• Target-Kategorie: HCRTR2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using HCRTR2 Rabbit pAb (A3057) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.