HCRTR2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A3057
Article Name: HCRTR2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A3057
Supplier Catalog Number: A3057
Alternative Catalog Number: ABB-A3057-1000UL,ABB-A3057-500UL,ABB-A3057-100UL,ABB-A3057-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OX2R, OXR2, ORXR2, HCRTR2
The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor that selectively binds orexin A.
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 3062
UniProt: O43614
Purity: Affinity purification
Sequence: SCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW
Target: HCRTR2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using HCRTR2 Rabbit pAb (A3057) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.