PPAP2A Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PPAP2A Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3062
• Hersteller Artikelnummer: A3062
• Alternativnummer: ABB-A3062-500UL,ABB-A3062-20UL,ABB-A3062-100UL,ABB-A3062-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LPP1, PAP2, LLP1a, PAP-2a, PPAP2A

Produktbeschreibung

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 32kDa
• NCBI: 8611
• UniProt: O14494
• Reinheit: Affinity purification
• Sequenz: MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYK
• Target-Kategorie: PLPP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PPAP2A Rabbit pAb (A3062) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.