PPAP2A Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PPAP2A Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3062
• Supplier Catalog Number: A3062
• Alternative Catalog Number: ABB-A3062-500UL,ABB-A3062-20UL,ABB-A3062-100UL,ABB-A3062-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LPP1, PAP2, LLP1a, PAP-2a, PPAP2A

Product Description

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 32kDa
• NCBI: 8611
• UniProt: O14494
• Purity: Affinity purification
• Sequence: MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYK
• Target: PLPP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PPAP2A Rabbit pAb (A3062) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.