PARD6A Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PARD6A Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3064
• Hersteller Artikelnummer: A3064
• Alternativnummer: ABB-A3064-500UL,ABB-A3064-1000UL,ABB-A3064-20UL,ABB-A3064-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PAR6, PAR6C, TAX40, PAR-6A, TIP-40, PAR6alpha, PARD6A

Produktbeschreibung

This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 37kDa
• NCBI: 50855
• UniProt: Q9NPB6
• Reinheit: Affinity purification
• Sequenz: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADS
• Target-Kategorie: PARD6A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell differentiation,Cell Adhesion,Tight Junctions,Cytoskeleton,TGF-b-Smad Signaling Pathway,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PARD6A Rabbit pAb (A3064) at 1:200 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.