PARD6A Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PARD6A Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3064
• Supplier Catalog Number: A3064
• Alternative Catalog Number: ABB-A3064-500UL,ABB-A3064-1000UL,ABB-A3064-20UL,ABB-A3064-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PAR6, PAR6C, TAX40, PAR-6A, TIP-40, PAR6alpha, PARD6A

Product Description

This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 37kDa
• NCBI: 50855
• UniProt: Q9NPB6
• Purity: Affinity purification
• Sequence: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADS
• Target: PARD6A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell differentiation,Cell Adhesion,Tight Junctions,Cytoskeleton,TGF-b-Smad Signaling Pathway,Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PARD6A Rabbit pAb (A3064) at 1:200 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.