PIWIL2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PIWIL2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3073
• Hersteller Artikelnummer: A3073
• Alternativnummer: ABB-A3073-1000UL,ABB-A3073-100UL,ABB-A3073-20UL,ABB-A3073-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CT80, HILI, mili, PIWIL1L, PIWIL2

Produktbeschreibung

PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 110kDa
• NCBI: 55124
• UniProt: Q8TC59
• Reinheit: Affinity purification
• Sequenz: LGRGLSANLVRKDREELSPTFWDPKVLAAGDSKMAETSVGWSRTLGRGSSDASLLPLGRAAGGISREVDKPPCTFSTPSRGPPQLSSPPALPQSPLHSPDR
• Target-Kategorie: PIWIL2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Stem Cells,Germline Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse testis, using PIWIL2 Rabbit pAb (A3073) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.