PIWIL2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PIWIL2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3073
• Supplier Catalog Number: A3073
• Alternative Catalog Number: ABB-A3073-1000UL,ABB-A3073-100UL,ABB-A3073-20UL,ABB-A3073-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CT80, HILI, mili, PIWIL1L, PIWIL2

Product Description

PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 110kDa
• NCBI: 55124
• UniProt: Q8TC59
• Purity: Affinity purification
• Sequence: LGRGLSANLVRKDREELSPTFWDPKVLAAGDSKMAETSVGWSRTLGRGSSDASLLPLGRAAGGISREVDKPPCTFSTPSRGPPQLSSPPALPQSPLHSPDR
• Target: PIWIL2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Stem Cells,Germline Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse testis, using PIWIL2 Rabbit pAb (A3073) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.