NKX2-1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NKX2-1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3097
• Hersteller Artikelnummer: A3097
• Alternativnummer: ABB-A3097-100UL,ABB-A3097-500UL,ABB-A3097-1000UL,ABB-A3097-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BCH, BHC, NK-2, TEBP, TTF1, NKX2A, NMTC1, T/EBP, TITF1, TTF-1, NKX2.1, NKX2-1

Produktbeschreibung

This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias TTF1 with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 39kDa
• NCBI: 7080
• UniProt: P43699
• Reinheit: Affinity purification
• Sequenz: LEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASG
• Target-Kategorie: NKX2-1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from NCI-H460 cells, using NKX2-1 Rabbit pAb (A3097) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.