NKX2-1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NKX2-1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3097
• Supplier Catalog Number: A3097
• Alternative Catalog Number: ABB-A3097-100UL,ABB-A3097-500UL,ABB-A3097-1000UL,ABB-A3097-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BCH, BHC, NK-2, TEBP, TTF1, NKX2A, NMTC1, T/EBP, TITF1, TTF-1, NKX2.1, NKX2-1

Product Description

This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias TTF1 with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 39kDa
• NCBI: 7080
• UniProt: P43699
• Purity: Affinity purification
• Sequence: LEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASG
• Target: NKX2-1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Images

Western blot analysis of lysates from NCI-H460 cells, using NKX2-1 Rabbit pAb (A3097) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.