MYSM1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: MYSM1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3102
• Hersteller Artikelnummer: A3102
• Alternativnummer: ABB-A3102-500UL,ABB-A3102-20UL,ABB-A3102-100UL,ABB-A3102-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: 2ADUB, BMFS4, 2A-DUB, MYSM1

Produktbeschreibung

Enables histone binding activity, peptidase activity, and transcription coactivator activity. Involved in several processes, including chromatin remodeling, monoubiquitinated histone H2A deubiquitination, and positive regulation of transcription by RNA polymerase II. Located in nucleolus and nucleoplasm. Part of protein-containing complex. Implicated in diabetic retinopathy.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 95kDa
• NCBI: 114803
• UniProt: Q5VVJ2
• Reinheit: Affinity purification
• Sequenz: SYRLPYKFEVQQMLEEPQWGLVFEKTRWIIEKYRLSHSSVPMDKIFRRDSDLTCLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEEN
• Target-Kategorie: MYSM1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using MYSM1 Rabbit pAb (A3102) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.