MYSM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A3102
Article Name: MYSM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A3102
Supplier Catalog Number: A3102
Alternative Catalog Number: ABB-A3102-500UL,ABB-A3102-20UL,ABB-A3102-100UL,ABB-A3102-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: 2ADUB, BMFS4, 2A-DUB, MYSM1
Enables histone binding activity, peptidase activity, and transcription coactivator activity. Involved in several processes, including chromatin remodeling, monoubiquitinated histone H2A deubiquitination, and positive regulation of transcription by RNA polymerase II. Located in nucleolus and nucleoplasm. Part of protein-containing complex. Implicated in diabetic retinopathy.
Clonality: Polyclonal
Molecular Weight: 95kDa
NCBI: 114803
UniProt: Q5VVJ2
Purity: Affinity purification
Sequence: SYRLPYKFEVQQMLEEPQWGLVFEKTRWIIEKYRLSHSSVPMDKIFRRDSDLTCLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEEN
Target: MYSM1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag
Western blot analysis of various lysates using MYSM1 Rabbit pAb (A3102) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.