MYSM1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MYSM1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3102
• Supplier Catalog Number: A3102
• Alternative Catalog Number: ABB-A3102-500UL,ABB-A3102-20UL,ABB-A3102-100UL,ABB-A3102-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: 2ADUB, BMFS4, 2A-DUB, MYSM1

Product Description

Enables histone binding activity, peptidase activity, and transcription coactivator activity. Involved in several processes, including chromatin remodeling, monoubiquitinated histone H2A deubiquitination, and positive regulation of transcription by RNA polymerase II. Located in nucleolus and nucleoplasm. Part of protein-containing complex. Implicated in diabetic retinopathy.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 95kDa
• NCBI: 114803
• UniProt: Q5VVJ2
• Purity: Affinity purification
• Sequence: SYRLPYKFEVQQMLEEPQWGLVFEKTRWIIEKYRLSHSSVPMDKIFRRDSDLTCLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEEN
• Target: MYSM1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag

Images

Western blot analysis of various lysates using MYSM1 Rabbit pAb (A3102) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.