Alpha Internexin Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Alpha Internexin Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3109
• Hersteller Artikelnummer: A3109
• Alternativnummer: ABB-A3109-1000UL,ABB-A3109-500UL,ABB-A3109-100UL,ABB-A3109-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NEF5, NF66, NF-66, TXBP-1, Alpha Internexin

Produktbeschreibung

Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 55kDa
• NCBI: 9118
• UniProt: Q16352
• Reinheit: Affinity purification
• Sequenz: SSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALRE
• Target-Kategorie: INA
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Intermediate Filaments,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using Alpha Internexin Rabbit pAb (A3109) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.