Alpha Internexin Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Alpha Internexin Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3109
• Supplier Catalog Number: A3109
• Alternative Catalog Number: ABB-A3109-1000UL,ABB-A3109-500UL,ABB-A3109-100UL,ABB-A3109-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NEF5, NF66, NF-66, TXBP-1, Alpha Internexin

Product Description

Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 55kDa
• NCBI: 9118
• UniProt: Q16352
• Purity: Affinity purification
• Sequence: SSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALRE
• Target: INA
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Intermediate Filaments,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using Alpha Internexin Rabbit pAb (A3109) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.