CD8B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A3286
- Bilder (1)
| Artikelname: | CD8B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A3286 |
| Hersteller Artikelnummer: | A3286 |
| Alternativnummer: | ABB-A3286-100UL,ABB-A3286-20UL,ABB-A3286-500UL,ABB-A3286-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LY3, P37, LEU2, LYT3, Ly-3, CD8B1, CD8beta, CD8B |
| The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 24kDa |
| NCBI: | 926 |
| UniProt: | P10966 |
| Reinheit: | Affinity purification |
| Sequenz: | LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP |
| Target-Kategorie: | CD8B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag |

