CD8B Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD8B Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3286
• Supplier Catalog Number: A3286
• Alternative Catalog Number: ABB-A3286-100UL,ABB-A3286-20UL,ABB-A3286-500UL,ABB-A3286-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LY3, P37, LEU2, LYT3, Ly-3, CD8B1, CD8beta, CD8B

Product Description

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 926
• UniProt: P10966
• Purity: Affinity purification
• Sequence: LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
• Target: CD8B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and293F cells transfected withCD8B usingCD8B Rabbit pAb (A3286) at1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:10s.