CNGA3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CNGA3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3288
• Hersteller Artikelnummer: A3288
• Alternativnummer: ABB-A3288-1000UL,ABB-A3288-100UL,ABB-A3288-20UL,ABB-A3288-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CNG3, ACHM2, CCNC1, CCNCa, CNCG3, CCNCalpha, CNGA3

Produktbeschreibung

This gene encodes a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in this gene are associated with achromatopsia (rod monochromacy) and color blindness. Two alternatively spliced transcripts encoding different isoforms have been described.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 79kDa
• NCBI: 1261
• UniProt: Q16281
• Reinheit: Affinity purification
• Sequenz: MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSS
• Target-Kategorie: CNGA3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CNGA3 Rabbit pAb (A3288) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.