CNGA3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CNGA3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3288
• Supplier Catalog Number: A3288
• Alternative Catalog Number: ABB-A3288-1000UL,ABB-A3288-100UL,ABB-A3288-20UL,ABB-A3288-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CNG3, ACHM2, CCNC1, CCNCa, CNCG3, CCNCalpha, CNGA3

Product Description

This gene encodes a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in this gene are associated with achromatopsia (rod monochromacy) and color blindness. Two alternatively spliced transcripts encoding different isoforms have been described.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 79kDa
• NCBI: 1261
• UniProt: Q16281
• Purity: Affinity purification
• Sequence: MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSS
• Target: CNGA3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CNGA3 Rabbit pAb (A3288) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.