KIAA0391 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: KIAA0391 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3360
• Hersteller Artikelnummer: A3360
• Alternativnummer: ABB-A3360-500UL,ABB-A3360-20UL,ABB-A3360-1000UL,ABB-A3360-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MRPP3, COXPD54, KIAA0391

Produktbeschreibung

Enables ribonuclease P activity. Involved in mitochondrial tRNA 5-end processing. Located in mitochondrion and nucleoplasm. Part of mitochondrial ribonuclease P complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 67kDa
• NCBI: 9692
• UniProt: O15091
• Reinheit: Affinity purification
• Sequenz: YPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKVRESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPYDEDLVERC
• Target-Kategorie: PRORP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using KIAA0391 Rabbit pAb (A3360) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.