KIAA0391 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A3360
- Bilder (1)
| Artikelname: | KIAA0391 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A3360 |
| Hersteller Artikelnummer: | A3360 |
| Alternativnummer: | ABB-A3360-500UL,ABB-A3360-20UL,ABB-A3360-1000UL,ABB-A3360-100UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MRPP3, COXPD54, KIAA0391 |
| Enables ribonuclease P activity. Involved in mitochondrial tRNA 5-end processing. Located in mitochondrion and nucleoplasm. Part of mitochondrial ribonuclease P complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 67kDa |
| NCBI: | 9692 |
| UniProt: | O15091 |
| Reinheit: | Affinity purification |
| Sequenz: | YPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKVRESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPYDEDLVERC |
| Target-Kategorie: | PRORP |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag |

