KIAA0391 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: KIAA0391 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3360
• Supplier Catalog Number: A3360
• Alternative Catalog Number: ABB-A3360-500UL,ABB-A3360-20UL,ABB-A3360-1000UL,ABB-A3360-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MRPP3, COXPD54, KIAA0391

Product Description

Enables ribonuclease P activity. Involved in mitochondrial tRNA 5-end processing. Located in mitochondrion and nucleoplasm. Part of mitochondrial ribonuclease P complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 67kDa
• NCBI: 9692
• UniProt: O15091
• Purity: Affinity purification
• Sequence: YPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKVRESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPYDEDLVERC
• Target: PRORP
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using KIAA0391 Rabbit pAb (A3360) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.