CREBZF Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CREBZF Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3477
• Hersteller Artikelnummer: A3477
• Alternativnummer: ABB-A3477-20UL,ABB-A3477-100UL,ABB-A3477-500UL,ABB-A3477-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ZF, SMILE, CREBZF

Produktbeschreibung

Enables identical protein binding activity. Involved in negative regulation of gene expression, epigenetic, regulation of transcription, DNA-templated, and response to virus. Located in mitochondrion and nucleoplasm.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 37kDa
• NCBI: 58487
• UniProt: Q9NS37
• Reinheit: Affinity purification
• Sequenz: MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGK
• Target-Kategorie: CREBZF
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CREBZF Rabbit pAb (A3477) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.