CREBZF Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CREBZF Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3477
• Supplier Catalog Number: A3477
• Alternative Catalog Number: ABB-A3477-20UL,ABB-A3477-100UL,ABB-A3477-500UL,ABB-A3477-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ZF, SMILE, CREBZF

Product Description

Enables identical protein binding activity. Involved in negative regulation of gene expression, epigenetic, regulation of transcription, DNA-templated, and response to virus. Located in mitochondrion and nucleoplasm.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 37kDa
• NCBI: 58487
• UniProt: Q9NS37
• Purity: Affinity purification
• Sequence: MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGK
• Target: CREBZF
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CREBZF Rabbit pAb (A3477) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.