SLC16A2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SLC16A2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3636
• Hersteller Artikelnummer: A3636
• Alternativnummer: ABB-A3636-20UL,ABB-A3636-100UL,ABB-A3636-500UL,ABB-A3636-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AHDS, MCT7, MCT8, XPCT, MCT 7, MCT 8, MRX22, DXS128, DXS128E, SLC16A2

Produktbeschreibung

This gene encodes an integral membrane protein that functions as a transporter of thyroid hormone. The encoded protein facilitates the cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues and likely plays an important role in the development of the central nervous system. Loss of function mutations in this gene are associated with psychomotor retardation in males while females exhibit no neurological defects and more moderate thyroid-deficient phenotypes. This gene is subject to X-chromosome inactivation. Mutations in this gene are the cause of Allan-Herndon-Dudley syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 60kDa
• NCBI: 6567
• UniProt: P36021
• Reinheit: Affinity purification
• Sequenz: MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFG
• Target-Kategorie: SLC16A2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using SLC16A2 Rabbit pAb (A3636) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.