SLC16A2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SLC16A2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3636
• Supplier Catalog Number: A3636
• Alternative Catalog Number: ABB-A3636-20UL,ABB-A3636-100UL,ABB-A3636-500UL,ABB-A3636-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: AHDS, MCT7, MCT8, XPCT, MCT 7, MCT 8, MRX22, DXS128, DXS128E, SLC16A2

Product Description

This gene encodes an integral membrane protein that functions as a transporter of thyroid hormone. The encoded protein facilitates the cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues and likely plays an important role in the development of the central nervous system. Loss of function mutations in this gene are associated with psychomotor retardation in males while females exhibit no neurological defects and more moderate thyroid-deficient phenotypes. This gene is subject to X-chromosome inactivation. Mutations in this gene are the cause of Allan-Herndon-Dudley syndrome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 60kDa
• NCBI: 6567
• UniProt: P36021
• Purity: Affinity purification
• Sequence: MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFG
• Target: SLC16A2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SLC16A2 Rabbit pAb (A3636) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.