CETN1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CETN1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3784
• Hersteller Artikelnummer: A3784
• Alternativnummer: ABB-A3784-20UL,ABB-A3784-100UL,ABB-A3784-1000UL,ABB-A3784-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CEN1, CETN, CETN1

Produktbeschreibung

The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 20kDa
• NCBI: 1068
• UniProt: Q12798
• Reinheit: Affinity purification
• Sequenz: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
• Target-Kategorie: CETN1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell differentiation. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CETN1 Rabbit pAb (A3784) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.