CETN1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CETN1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3784
• Supplier Catalog Number: A3784
• Alternative Catalog Number: ABB-A3784-20UL,ABB-A3784-100UL,ABB-A3784-1000UL,ABB-A3784-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CEN1, CETN, CETN1

Product Description

The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 20kDa
• NCBI: 1068
• UniProt: Q12798
• Purity: Affinity purification
• Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
• Target: CETN1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell differentiation. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CETN1 Rabbit pAb (A3784) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.