CKS2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CKS2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3791
• Hersteller Artikelnummer: A3791
• Alternativnummer: ABB-A3791-100UL,ABB-A3791-20UL,ABB-A3791-500UL,ABB-A3791-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CKSHS2, CKS2

Produktbeschreibung

CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 10kDa
• NCBI: 1164
• UniProt: P33552
• Reinheit: Affinity purification
• Sequenz: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
• Target-Kategorie: CKS2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from rat liver, using CKS2 Rabbit pAb (A3791) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.