CKS2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CKS2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3791
• Supplier Catalog Number: A3791
• Alternative Catalog Number: ABB-A3791-100UL,ABB-A3791-20UL,ABB-A3791-500UL,ABB-A3791-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CKSHS2, CKS2

Product Description

CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 10kDa
• NCBI: 1164
• UniProt: P33552
• Purity: Affinity purification
• Sequence: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
• Target: CKS2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag

Images

Western blot analysis of lysates from rat liver, using CKS2 Rabbit pAb (A3791) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.