EIF4A2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: EIF4A2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3849
• Hersteller Artikelnummer: A3849
• Alternativnummer: ABB-A3849-100UL,ABB-A3849-20UL,ABB-A3849-500UL,ABB-A3849-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DDX2B, EIF4A, EIF4F, BM-010, eIF4A-II, eIF-4A-II, EIF4A2

Produktbeschreibung

Enables ATP hydrolysis activity. Involved in negative regulation of RNA-directed 5-3 RNA polymerase activity. Located in perinuclear region of cytoplasm.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 46kDa
• NCBI: 1974
• UniProt: Q14240
• Reinheit: Affinity purification
• Sequenz: MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVE
• Target-Kategorie: EIF4A2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Translation Control,Regulation of eIF4 and p70 S6 Kinase. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using EIF4A2 Rabbit pAb (A3849) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.