EIF4A2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: EIF4A2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3849
• Supplier Catalog Number: A3849
• Alternative Catalog Number: ABB-A3849-100UL,ABB-A3849-20UL,ABB-A3849-500UL,ABB-A3849-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DDX2B, EIF4A, EIF4F, BM-010, eIF4A-II, eIF-4A-II, EIF4A2

Product Description

Enables ATP hydrolysis activity. Involved in negative regulation of RNA-directed 5-3 RNA polymerase activity. Located in perinuclear region of cytoplasm.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 46kDa
• NCBI: 1974
• UniProt: Q14240
• Purity: Affinity purification
• Sequence: MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVE
• Target: EIF4A2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Translation Control,Regulation of eIF4 and p70 S6 Kinase. Shipping: Ice Bag

Images

Western blot analysis of various lysates using EIF4A2 Rabbit pAb (A3849) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.